SCOP 1.71: Domain d1mreh2: 1mre H:116-227

Lineage for d1mreh2 (1mre H:116-227)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88576] (302 PDB entries)

8. Domain d1mreh2: 1mre H:116-227 [21073]
   Other proteins in same PDB: d1mreh1, d1mrel1, d1mrel2
   part of Fab Jel 103
   complexed with gdp, imd, zn

Details for d1mreh2

PDB Entry: 1mre, 2.3 Å

PDB Description: preparation, characterization and crystallization of an antibody fab fragment that recognizes rna. crystal structures of native fab and three fab-mononucleotide complexes

SCOP Domain Sequences for d1mreh2:

Sequence, based on SEQRES records:

>d1mreh2 b.1.1.2 (H:116-227) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)}
ttppsvyplapgcgdttgssvtlgclvkgyfpesvtvtwnsgslsssvhtfpallqsgly
tmsssvtvpsstwpsqtvtcsvahpassttvdkklep

Sequence, based on observed residues (ATOM records):

>d1mreh2 b.1.1.2 (H:116-227) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)}
ttppsvyplapgtgssvtlgclvkgyfpesvtvtwnsgslsssvhtfpallqsglytmss
svtvpsstwpsqtvtcsvahpassttvdkklep

Timeline for d1mreh2:

• d1mreh2 first appeared (with stable ids) in SCOP 1.55
  
• d1mreh2 appears in SCOP 1.69
  
• d1mreh2 appears in SCOP 1.73
  
• d1mreh2 appears in the current release, SCOPe 2.08