SCOP 1.61: Domain d1mreh2: 1mre H:116-227

Lineage for d1mreh2 (1mre H:116-227)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (180 species)

7. Species Fab Jel 103 (mouse), kappa L chain [49014] (4 PDB entries)

8. Domain d1mreh2: 1mre H:116-227 [21073]
   Other proteins in same PDB: d1mreh1, d1mrel1

Details for d1mreh2

PDB Entry: 1mre, 2.3 Å

PDB Description: preparation, characterization and crystallization of an antibody fab fragment that recognizes rna. crystal structures of native fab and three fab-mononucleotide complexes

SCOP Domain Sequences for d1mreh2:

Sequence, based on SEQRES records:

>d1mreh2 b.1.1.2 (H:116-227) Immunoglobulin (constant domains of L and H chains) {Fab Jel 103 (mouse), kappa L chain}
ttppsvyplapgcgdttgssvtlgclvkgyfpesvtvtwnsgslsssvhtfpallqsgly
tmsssvtvpsstwpsqtvtcsvahpassttvdkklep

Sequence, based on observed residues (ATOM records):

>d1mreh2 b.1.1.2 (H:116-227) Immunoglobulin (constant domains of L and H chains) {Fab Jel 103 (mouse), kappa L chain}
ttppsvyplapgtgssvtlgclvkgyfpesvtvtwnsgslsssvhtfpallqsglytmss
svtvpsstwpsqtvtcsvahpassttvdkklep

Timeline for d1mreh2:

• d1mreh2 first appeared (with stable ids) in SCOP 1.55
  
• d1mreh2 appears in SCOP 1.59
  
• d1mreh2 appears in SCOP 1.63
  
• d1mreh2 appears in the current release, SCOPe 2.08