Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) |
Family c.1.8.3: beta-glycanases [51487] (27 proteins) consist of a number of sequence families |
Protein Glucosylceramidase, catalytic domain [89473] (1 species) acid-beta-glucosidase; glycosyl hydrolase family 30; contains additional beta-domain similar to one found in alpha amylases |
Species Human (Homo sapiens) [TaxId:9606] [89474] (17 PDB entries) |
Domain d3gxmd2: 3gxm D:78-431 [210721] Other proteins in same PDB: d3gxma1, d3gxmb1, d3gxmc1, d3gxmd1 automated match to d1ogsa2 complexed with nag, so4 |
PDB Entry: 3gxm (more details), 2.2 Å
SCOPe Domain Sequences for d3gxmd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3gxmd2 c.1.8.3 (D:78-431) Glucosylceramidase, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} vkgfggamtdaaalnilalsppaqnlllksyfseegigyniirvpmascdfsirtytyad tpddfqlhnfslpeedtklkiplihralqlaqrpvsllaspwtsptwlktngavngkgsl kgqpgdiyhqtwaryfvkfldayaehklqfwavtaenepsagllsgypfqclgftpehqr dfiardlgptlansthhnvrllmlddqrlllphwakvvltdpeaakyvhgiavhwyldfl apakatlgethrlfpntmlfaseacvgskfweqsvrlgswdrgmqyshsiitnllyhvvg wtdwnlalnpeggpnwvrnfvdspiivditkdtfykqpmfyhlghfskfipegs
Timeline for d3gxmd2: