SCOP 1.71: Domain d1mrel2: 1mre L:109-213

Lineage for d1mrel2 (1mre L:109-213)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88567] (284 PDB entries)

8. Domain d1mrel2: 1mre L:109-213 [21072]
   Other proteins in same PDB: d1mreh1, d1mreh2, d1mrel1
   part of Fab Jel 103
   complexed with gdp, imd, zn

Details for d1mrel2

PDB Entry: 1mre, 2.3 Å

PDB Description: preparation, characterization and crystallization of an antibody fab fragment that recognizes rna. crystal structures of native fab and three fab-mononucleotide complexes

SCOP Domain Sequences for d1mrel2:

Sequence; same for both SEQRES and ATOM records:

>d1mrel2 b.1.1.2 (L:109-213) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus)}
adaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgkerqngvlnswtdqns
kdstysmsstltltkdeyerhnsytceathktstspivksfnrne

Timeline for d1mrel2:

• d1mrel2 first appeared (with stable ids) in SCOP 1.55
  
• d1mrel2 appears in SCOP 1.69
  
• d1mrel2 appears in SCOP 1.73
  
• d1mrel2 appears in the current release, SCOPe 2.08