Lineage for d1mrel2 (1mre L:109-213)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 287096Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 288543Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
  6. 289615Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)
  7. 289708Species Mouse (Mus musculus) [TaxId:10090] [88567] (225 PDB entries)
  8. 289803Domain d1mrel2: 1mre L:109-213 [21072]
    Other proteins in same PDB: d1mreh1, d1mreh2, d1mrel1
    part of Fab Jel 103
    complexed with gdp, imd, zn

Details for d1mrel2

PDB Entry: 1mre (more details), 2.3 Å

PDB Description: preparation, characterization and crystallization of an antibody fab fragment that recognizes rna. crystal structures of native fab and three fab-mononucleotide complexes

SCOP Domain Sequences for d1mrel2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mrel2 b.1.1.2 (L:109-213) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus)}
adaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgkerqngvlnswtdqns
kdstysmsstltltkdeyerhnsytceathktstspivksfnrne

SCOP Domain Coordinates for d1mrel2:

Click to download the PDB-style file with coordinates for d1mrel2.
(The format of our PDB-style files is described here.)

Timeline for d1mrel2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1mrel1