SCOP 1.63: Domain d1mrel2: 1mre L:109-213

Lineage for d1mrel2 (1mre L:109-213)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species)

7. Species Fab Jel 103 (mouse), kappa L chain [49014] (4 PDB entries)

8. Domain d1mrel2: 1mre L:109-213 [21072]
   Other proteins in same PDB: d1mreh1, d1mrel1

Details for d1mrel2

PDB Entry: 1mre, 2.3 Å

PDB Description: preparation, characterization and crystallization of an antibody fab fragment that recognizes rna. crystal structures of native fab and three fab-mononucleotide complexes

SCOP Domain Sequences for d1mrel2:

Sequence; same for both SEQRES and ATOM records:

>d1mrel2 b.1.1.2 (L:109-213) Immunoglobulin (constant domains of L and H chains) {Fab Jel 103 (mouse), kappa L chain}
adaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgkerqngvlnswtdqns
kdstysmsstltltkdeyerhnsytceathktstspivksfnrne

Timeline for d1mrel2:

• d1mrel2 first appeared (with stable ids) in SCOP 1.55
  
• d1mrel2 appears in SCOP 1.61
  
• d1mrel2 appears in SCOP 1.65
  
• d1mrel2 appears in the current release, SCOPe 2.08