| Class b: All beta proteins [48724] (119 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
| Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species) |
| Species Fab Jel 103 (mouse), kappa L chain [49014] (4 PDB entries) |
| Domain d1mrel2: 1mre L:109-213 [21072] Other proteins in same PDB: d1mreh1, d1mrel1 |
PDB Entry: 1mre (more details), 2.3 Å
SCOP Domain Sequences for d1mrel2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mrel2 b.1.1.2 (L:109-213) Immunoglobulin (constant domains of L and H chains) {Fab Jel 103 (mouse), kappa L chain}
adaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgkerqngvlnswtdqns
kdstysmsstltltkdeyerhnsytceathktstspivksfnrne
Timeline for d1mrel2: