![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies) core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down |
![]() | Superfamily a.24.15: FAD-dependent thiol oxidase [69000] (2 families) ![]() |
![]() | Family a.24.15.0: automated matches [191449] (1 protein) not a true family |
![]() | Protein automated matches [190684] (3 species) not a true protein |
![]() | Species African swine fever virus ba71v [TaxId:10498] [225717] (1 PDB entry) |
![]() | Domain d3gwla1: 3gwl A:101-203 [210688] Other proteins in same PDB: d3gwla2, d3gwlb2 automated match to d2hj3b_ complexed with fad |
PDB Entry: 3gwl (more details), 2.1 Å
SCOPe Domain Sequences for d3gwla1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3gwla1 a.24.15.0 (A:101-203) automated matches {African swine fever virus ba71v [TaxId: 10498]} mlhwgpkywrslhlyaiffsdapswkekyeaiqwilnfieslpctrcqhhafsyltknpl tlnnsedfqywtfafhnnvnnrlnkkiiswseykniyeqsilk
Timeline for d3gwla1: