SCOPe 2.08: Domain d3gwla1: 3gwl A:101-203

Lineage for d3gwla1 (3gwl A:101-203)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.15: FAD-dependent thiol oxidase [69000] (2 families)

5. Family a.24.15.0: automated matches [191449] (1 protein)
   not a true family

6. Protein automated matches [190684] (3 species)
   not a true protein

7. Species African swine fever virus ba71v [TaxId:10498] [225717] (1 PDB entry)

8. Domain d3gwla1: 3gwl A:101-203 [210688]
   Other proteins in same PDB: d3gwla2, d3gwlb2
   automated match to d2hj3b_
   complexed with fad

Details for d3gwla1

PDB Entry: 3gwl, 2.1 Å

PDB Description: crystal structure of asfv pb119l, a viral sulfhydryl oxidase

PDB Compounds: (A:) FAD-linked sulfhydryl oxidase

SCOPe Domain Sequences for d3gwla1:

Sequence; same for both SEQRES and ATOM records:

>d3gwla1 a.24.15.0 (A:101-203) automated matches {African swine fever virus ba71v [TaxId: 10498]}
mlhwgpkywrslhlyaiffsdapswkekyeaiqwilnfieslpctrcqhhafsyltknpl
tlnnsedfqywtfafhnnvnnrlnkkiiswseykniyeqsilk

Timeline for d3gwla1:

• d3gwla1 first appeared in SCOPe 2.03, called d3gwla_
  
• d3gwla1 appears in SCOPe 2.07