Lineage for d3gvid2 (3gvi D:145-319)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2556795Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 2556796Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 2557402Family d.162.1.0: automated matches [227146] (1 protein)
    not a true family
  6. 2557403Protein automated matches [226850] (33 species)
    not a true protein
  7. 2557438Species Brucella melitensis [TaxId:359391] [225649] (2 PDB entries)
  8. 2557442Domain d3gvid2: 3gvi D:145-319 [210682]
    Other proteins in same PDB: d3gvia1, d3gvib1, d3gvic1, d3gvid1, d3gvie1, d3gvif1
    automated match to d1guza2
    complexed with adp

Details for d3gvid2

PDB Entry: 3gvi (more details), 2.25 Å

PDB Description: Crystal structure of Lactate/malate dehydrogenase from Brucella melitensis in complex with ADP
PDB Compounds: (D:) malate dehydrogenase

SCOPe Domain Sequences for d3gvid2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gvid2 d.162.1.0 (D:145-319) automated matches {Brucella melitensis [TaxId: 359391]}
agvldsarfryflseefnvsvedvtvfvlgghgdsmvplarystvagiplpdlvkmgwts
qdkldkiiqrtrdggaeivgllktgsafyapaasaiqmaesylkdkkrvlpvaaqlsgqy
gvkdmyvgvptvigangveriieidldkdekaqfdksvasvaglceacigiapsl

SCOPe Domain Coordinates for d3gvid2:

Click to download the PDB-style file with coordinates for d3gvid2.
(The format of our PDB-style files is described here.)

Timeline for d3gvid2: