| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
| Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
| Protein automated matches [190069] (319 species) not a true protein |
| Species Brucella melitensis [TaxId:359391] [189369] (3 PDB entries) |
| Domain d3gvib1: 3gvi B:2-144 [210677] Other proteins in same PDB: d3gvia2, d3gvib2, d3gvic2, d3gvid2, d3gvie2, d3gvif2 automated match to d1guza1 complexed with adp |
PDB Entry: 3gvi (more details), 2.25 Å
SCOPe Domain Sequences for d3gvib1:
Sequence, based on SEQRES records: (download)
>d3gvib1 c.2.1.0 (B:2-144) automated matches {Brucella melitensis [TaxId: 359391]}
arnkialigsgmiggtlahlaglkelgdvvlfdiaegtpqgkgldiaesspvdgfdakft
gandyaaiegadvvivtagvprkpgmsrddllginlkvmeqvgagikkyapeafvicitn
pldamvwalqkfsglpahkvvgm
>d3gvib1 c.2.1.0 (B:2-144) automated matches {Brucella melitensis [TaxId: 359391]}
arnkialigsgmiggtlahlaglkelgdvvlfdiaegtpqgkgldiaesspvdgfdakft
gandyaaiegadvvivtagvprkddllginlkvmeqvgagikkyapeafvicitnpldam
vwalqkfsglpahkvvgm
Timeline for d3gvib1: