SCOP 1.69: Domain d1knof2: 1kno F:120-235

Lineage for d1knof2 (1kno F:120-235)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88576] (295 PDB entries)

8. Domain d1knof2: 1kno F:120-235 [21067]
   Other proteins in same PDB: d1knoa1, d1knoa2, d1knob1, d1knoc1, d1knoc2, d1knod1, d1knoe1, d1knoe2, d1knof1
   part of Fab CNJ206

Details for d1knof2

PDB Entry: 1kno, 3.2 Å

PDB Description: crystal structure of the complex of a catalytic antibody fab with a transition state analog: structural similarities in esterase-like abzymes

SCOP Domain Sequences for d1knof2:

Sequence; same for both SEQRES and ATOM records:

>d1knof2 b.1.1.2 (F:120-235) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)}
akttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsd
lytlsssvtvtsstwpsqsitcnvahpasstkvdkkieprg

Timeline for d1knof2:

• d1knof2 first appeared (with stable ids) in SCOP 1.55
  
• d1knof2 appears in SCOP 1.67
  
• d1knof2 appears in SCOP 1.71
  
• d1knof2 appears in the current release, SCOPe 2.08