Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (239 species) not a true protein |
Species Brucella melitensis [TaxId:359391] [189369] (3 PDB entries) |
Domain d3gvha1: 3gvh A:2-144 [210667] Other proteins in same PDB: d3gvha2, d3gvhb2, d3gvhc2, d3gvhd2 automated match to d1guza1 complexed with nad |
PDB Entry: 3gvh (more details), 2.3 Å
SCOPe Domain Sequences for d3gvha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3gvha1 c.2.1.0 (A:2-144) automated matches {Brucella melitensis [TaxId: 359391]} arnkialigsgmiggtlahlaglkelgdvvlfdiaegtpqgkgldiaesspvdgfdakft gandyaaiegadvvivtagvprkpgmsrddllginlkvmeqvgagikkyapeafvicitn pldamvwalqkfsglpahkvvgm
Timeline for d3gvha1: