Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (2 families) |
Family c.1.1.0: automated matches [191424] (1 protein) not a true family |
Protein automated matches [190605] (13 species) not a true protein |
Species Mycobacterium tuberculosis [TaxId:1773] [225650] (1 PDB entry) |
Domain d3gvgb_: 3gvg B: [210666] automated match to d3ta6b_ complexed with gol |
PDB Entry: 3gvg (more details), 1.55 Å
SCOPe Domain Sequences for d3gvgb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3gvgb_ c.1.1.0 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]} srkpliagnwkmnlnhyeaialvqkiafslpdkyydrvdvavippftdlrsvqtlvdgdk lrltygaqdlsphdsgaytgdvsgaflaklgcsyvvvghserrtyhneddalvaakaata lkhgltpivcigehldvreagnhvahnieqlrgslagllaeqigsvviayepvwaigtgr vasaadaqevcaairkelaslaspriadtvrvlyggsvnaknvgdivaqddvdgglvgga sldgehfatlaaiaag
Timeline for d3gvgb_: