SCOPe 2.04: Domain d3gvgb_: 3gvg B:

Lineage for d3gvgb_ (3gvg B:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (2 families)

5. Family c.1.1.0: automated matches [191424] (1 protein)
   not a true family

6. Protein automated matches [190605] (13 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:1773] [225650] (1 PDB entry)

8. Domain d3gvgb_: 3gvg B: [210666]
   automated match to d3ta6b_
   complexed with gol

Details for d3gvgb_

PDB Entry: 3gvg, 1.55 Å

PDB Description: crystal structure of triosephosphate isomerase from mycobacterium tuberculosis

PDB Compounds: (B:) triosephosphate isomerase

SCOPe Domain Sequences for d3gvgb_:

Sequence; same for both SEQRES and ATOM records:

>d3gvgb_ c.1.1.0 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
srkpliagnwkmnlnhyeaialvqkiafslpdkyydrvdvavippftdlrsvqtlvdgdk
lrltygaqdlsphdsgaytgdvsgaflaklgcsyvvvghserrtyhneddalvaakaata
lkhgltpivcigehldvreagnhvahnieqlrgslagllaeqigsvviayepvwaigtgr
vasaadaqevcaairkelaslaspriadtvrvlyggsvnaknvgdivaqddvdgglvgga
sldgehfatlaaiaag

Timeline for d3gvgb_:

• d3gvgb_ first appeared in SCOPe 2.03
  
• d3gvgb_ appears in SCOPe 2.05
  
• d3gvgb_ appears in the current release, SCOPe 2.08