SCOPe 2.08: Domain d3gusb2: 3gus B:77-209

Lineage for d3gusb2 (3gus B:77-209)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)

6. Protein Class pi GST [81347] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47619] (67 PDB entries)

8. Domain d3gusb2: 3gus B:77-209 [210663]
   Other proteins in same PDB: d3gusa1, d3gusb1
   automated match to d1aqwa1
   complexed with gsh, mes, n11, so4

Details for d3gusb2

PDB Entry: 3gus, 1.53 Å

PDB Description: Crystal strcture of human Pi class glutathione S-transferase GSTP1-1 in complex with 6-(7-Nitro-2,1,3-benzoxadiazol-4-ylthio)hexanol (NBDHEX)

PDB Compounds: (B:) Glutathione S-transferase P

SCOPe Domain Sequences for d3gusb2:

Sequence; same for both SEQRES and ATOM records:

>d3gusb2 a.45.1.1 (B:77-209) Class pi GST {Human (Homo sapiens) [TaxId: 9606]}
glygkdqqeaalvdmvndgvedlrckyisliytnyeagkddyvkalpgqlkpfetllsqn
qggktfivgdqisfadynlldlllihevlapgcldafpllsayvgrlsarpklkaflasp
eyvnlpingngkq

Timeline for d3gusb2:

• d3gusb2 first appeared in SCOPe 2.03
  
• d3gusb2 appears in SCOPe 2.07