Lineage for d3gusa2 (3gus A:77-209)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1270513Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 1270514Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 1270515Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)
  6. 1270840Protein Class pi GST [81347] (4 species)
  7. 1270841Species Human (Homo sapiens) [TaxId:9606] [47619] (52 PDB entries)
  8. 1270866Domain d3gusa2: 3gus A:77-209 [210661]
    Other proteins in same PDB: d3gusa1, d3gusb1
    automated match to d1aqwa1
    complexed with gsh, mes, n11, so4

Details for d3gusa2

PDB Entry: 3gus (more details), 1.53 Å

PDB Description: Crystal strcture of human Pi class glutathione S-transferase GSTP1-1 in complex with 6-(7-Nitro-2,1,3-benzoxadiazol-4-ylthio)hexanol (NBDHEX)
PDB Compounds: (A:) Glutathione S-transferase P

SCOPe Domain Sequences for d3gusa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gusa2 a.45.1.1 (A:77-209) Class pi GST {Human (Homo sapiens) [TaxId: 9606]}
glygkdqqeaalvdmvndgvedlrckyisliytnyeagkddyvkalpgqlkpfetllsqn
qggktfivgdqisfadynlldlllihevlapgcldafpllsayvgrlsarpklkaflasp
eyvnlpingngkq

SCOPe Domain Coordinates for d3gusa2:

Click to download the PDB-style file with coordinates for d3gusa2.
(The format of our PDB-style files is described here.)

Timeline for d3gusa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3gusa1