Lineage for d1knoe2 (1kno E:109-214)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 546418Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 546419Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 548299Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 549707Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)
  7. 549856Species Mouse (Mus musculus) [TaxId:10090] [88567] (284 PDB entries)
  8. 550163Domain d1knoe2: 1kno E:109-214 [21066]
    Other proteins in same PDB: d1knoa1, d1knob1, d1knob2, d1knoc1, d1knod1, d1knod2, d1knoe1, d1knof1, d1knof2
    part of Fab CNJ206
    complexed with pnp, zn

Details for d1knoe2

PDB Entry: 1kno (more details), 3.2 Å

PDB Description: crystal structure of the complex of a catalytic antibody fab with a transition state analog: structural similarities in esterase-like abzymes

SCOP Domain Sequences for d1knoe2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1knoe2 b.1.1.2 (E:109-214) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus)}
adaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqds
kdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

SCOP Domain Coordinates for d1knoe2:

Click to download the PDB-style file with coordinates for d1knoe2.
(The format of our PDB-style files is described here.)

Timeline for d1knoe2: