Lineage for d3gurd2 (3gur D:85-217)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712830Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2712831Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2712832Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)
  6. 2713057Protein Class mu GST [81348] (3 species)
  7. 2713065Species Human (Homo sapiens) [TaxId:9606] [47622] (17 PDB entries)
    Uniprot P09488 P28161
  8. 2713096Domain d3gurd2: 3gur D:85-217 [210659]
    Other proteins in same PDB: d3gura1, d3gurb1, d3gurc1, d3gurd1
    automated match to d1xw5a1
    complexed with byg, edo, gsh

Details for d3gurd2

PDB Entry: 3gur (more details), 2.5 Å

PDB Description: crystal structure of mu class glutathione s-transferase (gstm2-2) in complex with glutathione and 6-(7-nitro-2,1,3-benzoxadiazol-4- ylthio)hexanol (nbdhex)
PDB Compounds: (D:) Glutathione S-transferase Mu 2

SCOPe Domain Sequences for d3gurd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gurd2 a.45.1.1 (D:85-217) Class mu GST {Human (Homo sapiens) [TaxId: 9606]}
lcgesekeqiredilenqfmdsrmqlaklcydpdfeklkpeylqalpemlklysqflgkq
pwflgdkitfvdfiaydvlernqvfepscldafpnlkdfisrfeglekisaymkssrflp
rpvftkmavwgnk

SCOPe Domain Coordinates for d3gurd2:

Click to download the PDB-style file with coordinates for d3gurd2.
(The format of our PDB-style files is described here.)

Timeline for d3gurd2: