SCOPe 2.07: Domain d3gurc2: 3gur C:85-217

Lineage for d3gurc2 (3gur C:85-217)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)

6. Protein Class mu GST [81348] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47622] (16 PDB entries)
   Uniprot P09488 P28161

8. Domain d3gurc2: 3gur C:85-217 [210657]
   Other proteins in same PDB: d3gura1, d3gurb1, d3gurc1, d3gurd1
   automated match to d1xw5a1
   complexed with byg, edo, gsh

Details for d3gurc2

PDB Entry: 3gur, 2.5 Å

PDB Description: crystal structure of mu class glutathione s-transferase (gstm2-2) in complex with glutathione and 6-(7-nitro-2,1,3-benzoxadiazol-4- ylthio)hexanol (nbdhex)

PDB Compounds: (C:) Glutathione S-transferase Mu 2

SCOPe Domain Sequences for d3gurc2:

Sequence; same for both SEQRES and ATOM records:

>d3gurc2 a.45.1.1 (C:85-217) Class mu GST {Human (Homo sapiens) [TaxId: 9606]}
lcgesekeqiredilenqfmdsrmqlaklcydpdfeklkpeylqalpemlklysqflgkq
pwflgdkitfvdfiaydvlernqvfepscldafpnlkdfisrfeglekisaymkssrflp
rpvftkmavwgnk

Timeline for d3gurc2:

• d3gurc2 first appeared in SCOPe 2.03
  
• d3gurc2 appears in SCOPe 2.06
  
• d3gurc2 appears in the current release, SCOPe 2.08