Class a: All alpha proteins [46456] (289 folds) |
Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) this domains follows the thioredoxin-like N-terminal domain |
Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins) |
Protein Class mu GST [81348] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [47622] (16 PDB entries) Uniprot P09488 P28161 |
Domain d3gurb2: 3gur B:85-216 [210655] Other proteins in same PDB: d3gura1, d3gurb1, d3gurc1, d3gurd1 automated match to d1xw5a1 complexed with byg, edo, gsh |
PDB Entry: 3gur (more details), 2.5 Å
SCOPe Domain Sequences for d3gurb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3gurb2 a.45.1.1 (B:85-216) Class mu GST {Human (Homo sapiens) [TaxId: 9606]} lcgesekeqiredilenqfmdsrmqlaklcydpdfeklkpeylqalpemlklysqflgkq pwflgdkitfvdfiaydvlernqvfepscldafpnlkdfisrfeglekisaymkssrflp rpvftkmavwgn
Timeline for d3gurb2: