SCOPe 2.08: Domain d3gura1: 3gur A:1-84

Lineage for d3gura1 (3gur A:1-84)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)

6. Protein Class mu GST [81359] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52867] (17 PDB entries)
   Uniprot P09488 ! Uniprot P28161

8. Domain d3gura1: 3gur A:1-84 [210652]
   Other proteins in same PDB: d3gura2, d3gurb2, d3gurc2, d3gurd2
   automated match to d1xw5a2
   complexed with byg, edo, gsh

Details for d3gura1

PDB Entry: 3gur, 2.5 Å

PDB Description: crystal structure of mu class glutathione s-transferase (gstm2-2) in complex with glutathione and 6-(7-nitro-2,1,3-benzoxadiazol-4- ylthio)hexanol (nbdhex)

PDB Compounds: (A:) Glutathione S-transferase Mu 2

SCOPe Domain Sequences for d3gura1:

Sequence; same for both SEQRES and ATOM records:

>d3gura1 c.47.1.5 (A:1-84) Class mu GST {Human (Homo sapiens) [TaxId: 9606]}
pmtlgywnirglahsirllleytdssyeekkytmgdapdydrsqwlnekfklgldfpnlp
ylidgthkitqsnailryiarkhn

Timeline for d3gura1:

• d3gura1 first appeared in SCOPe 2.03
  
• d3gura1 appears in SCOPe 2.07