Lineage for d3gtda_ (3gtd A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2010255Fold a.127: L-aspartase-like [48556] (1 superfamily)
    multihelical, consists of three all-alpha domains
  4. 2010256Superfamily a.127.1: L-aspartase-like [48557] (3 families) (S)
  5. 2010257Family a.127.1.1: L-aspartase/fumarase [48558] (6 protein domains)
  6. 2010373Protein automated matches [190147] (7 species)
    not a true protein
  7. 2010391Species Rickettsia prowazekii [TaxId:272947] [225716] (1 PDB entry)
  8. 2010392Domain d3gtda_: 3gtd A: [210651]
    automated match to d1fuob_
    complexed with mli, na

Details for d3gtda_

PDB Entry: 3gtd (more details), 2.4 Å

PDB Description: 2.4 Angstrom crystal structure of fumarate hydratase from Rickettsia prowazekii
PDB Compounds: (A:) fumarate hydratase class II

SCOPe Domain Sequences for d3gtda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gtda_ a.127.1.1 (A:) automated matches {Rickettsia prowazekii [TaxId: 272947]}
nyriesdsfgeiqieekfywgaqtqrslnnfkiskqkmpkiliralailkkcaaqvnyef
gdleykiatsidkaidrilagefednfplvvwqtgsgtqtnmnmneviasianeeltgkk
ggkfpvhpndhvnkgqssndsfptamhiatvlatkqqlipalnnlltylqdkskdwdkii
kigrthlqdatpltlkqefsgyitqieyaleriedalkkvyllaqggtavgtginskigf
dikfaqkvaeftqqpfktapnkfeslaahdalvefsgtlntiavslmkiandirllgsgp
rcglgelhlpenepgssimpgkvnptqvealtmvctqvmgnhvtvtiagsnghlelnvfk
pviiynilqsiellsdsvnsfvthcvkglepniarintlrdkslmlvtvlnphigydnaa
kiakeahkygitlkeaakklnflseeefdkivvpe

SCOPe Domain Coordinates for d3gtda_:

Click to download the PDB-style file with coordinates for d3gtda_.
(The format of our PDB-style files is described here.)

Timeline for d3gtda_: