![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.127: L-aspartase-like [48556] (1 superfamily) multihelical, consists of three all-alpha domains |
![]() | Superfamily a.127.1: L-aspartase-like [48557] (3 families) ![]() |
![]() | Family a.127.1.1: L-aspartase/fumarase [48558] (6 proteins) |
![]() | Protein automated matches [190147] (10 species) not a true protein |
![]() | Species Rickettsia prowazekii [TaxId:272947] [225716] (1 PDB entry) |
![]() | Domain d3gtda_: 3gtd A: [210651] automated match to d1fuob_ complexed with mli, na |
PDB Entry: 3gtd (more details), 2.4 Å
SCOPe Domain Sequences for d3gtda_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3gtda_ a.127.1.1 (A:) automated matches {Rickettsia prowazekii [TaxId: 272947]} nyriesdsfgeiqieekfywgaqtqrslnnfkiskqkmpkiliralailkkcaaqvnyef gdleykiatsidkaidrilagefednfplvvwqtgsgtqtnmnmneviasianeeltgkk ggkfpvhpndhvnkgqssndsfptamhiatvlatkqqlipalnnlltylqdkskdwdkii kigrthlqdatpltlkqefsgyitqieyaleriedalkkvyllaqggtavgtginskigf dikfaqkvaeftqqpfktapnkfeslaahdalvefsgtlntiavslmkiandirllgsgp rcglgelhlpenepgssimpgkvnptqvealtmvctqvmgnhvtvtiagsnghlelnvfk pviiynilqsiellsdsvnsfvthcvkglepniarintlrdkslmlvtvlnphigydnaa kiakeahkygitlkeaakklnflseeefdkivvpe
Timeline for d3gtda_: