Lineage for d1knod2 (1kno D:120-235)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 655111Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)
  7. 655348Species Mouse (Mus musculus) [TaxId:10090] [88576] (330 PDB entries)
  8. 655718Domain d1knod2: 1kno D:120-235 [21065]
    Other proteins in same PDB: d1knoa1, d1knoa2, d1knob1, d1knoc1, d1knoc2, d1knod1, d1knoe1, d1knoe2, d1knof1

Details for d1knod2

PDB Entry: 1kno (more details), 3.2 Å

PDB Description: crystal structure of the complex of a catalytic antibody fab with a transition state analog: structural similarities in esterase-like abzymes
PDB Compounds: (D:) igg2a fab fragment cnj206

SCOP Domain Sequences for d1knod2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1knod2 b.1.1.2 (D:120-235) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]}
akttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsd
lytlsssvtvtsstwpsqsitcnvahpasstkvdkkieprg

SCOP Domain Coordinates for d1knod2:

Click to download the PDB-style file with coordinates for d1knod2.
(The format of our PDB-style files is described here.)

Timeline for d1knod2: