SCOPe 2.08: Domain d3grwa1: 3grw A:150-247

Lineage for d3grwa1 (3grw A:150-247)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d3grwa1: 3grw A:150-247 [210646]
   Other proteins in same PDB: d3grwl2
   automated match to d1djsa1
   complexed with nag, so4

Details for d3grwa1

PDB Entry: 3grw, 2.1 Å

PDB Description: fgfr3 in complex with a fab

PDB Compounds: (A:) Fibroblast growth factor receptor 3

SCOPe Domain Sequences for d3grwa1:

Sequence; same for both SEQRES and ATOM records:

>d3grwa1 b.1.1.0 (A:150-247) automated matches {Human (Homo sapiens) [TaxId: 9606]}
apywtrpermdkkllavpaantvrfrcpaagnptpsiswlkngrefrgehriggiklrhq
qwslvmesvvpsdrgnytcvvenkfgsirqtytldvle

Timeline for d3grwa1:

• d3grwa1 first appeared in SCOPe 2.03
  
• d3grwa1 appears in SCOPe 2.07