Lineage for d3grfa2 (3grf A:150-325)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2139045Fold c.78: ATC-like [53670] (2 superfamilies)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134
  4. 2139046Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families) (S)
  5. 2139496Family c.78.1.0: automated matches [227206] (1 protein)
    not a true family
  6. 2139497Protein automated matches [226938] (22 species)
    not a true protein
  7. 2139566Species Giardia intestinalis [TaxId:5741] [225692] (1 PDB entry)
  8. 2139568Domain d3grfa2: 3grf A:150-325 [210645]
    automated match to d1fb5a2
    complexed with ni

Details for d3grfa2

PDB Entry: 3grf (more details), 2 Å

PDB Description: X-ray Structure of Ornithine Transcarbamoylase from Giardia lamblia
PDB Compounds: (A:) ornithine carbamoyltransferase

SCOPe Domain Sequences for d3grfa2:

Sequence, based on SEQRES records: (download)

>d3grfa2 c.78.1.0 (A:150-325) automated matches {Giardia intestinalis [TaxId: 5741]}
aagefsngfkgikfaycgdsmnnvtydlmrgcallgmechvccpdhkdfkpikevidece
eiiakhgtggsikifhdckkgcegvdvvytdswmsyhitkeqkearlkvltpfqvddavm
avtskrsifmnclpatrgeeqtasvidgpksvcydeagnrlhsamavldfflhdck

Sequence, based on observed residues (ATOM records): (download)

>d3grfa2 c.78.1.0 (A:150-325) automated matches {Giardia intestinalis [TaxId: 5741]}
aagefsngfkgikfaycgdsmnnvtydlmrgcallgmechvccpdhkdfkpikevidece
eiiakhgtggsikifhdckkgcegvdvvytdswmkearlkvltpfqvddavmavtskrsi
fmnclpatrgeeqtasvidgpksvcydeagnrlhsamavldfflhdck

SCOPe Domain Coordinates for d3grfa2:

Click to download the PDB-style file with coordinates for d3grfa2.
(The format of our PDB-style files is described here.)

Timeline for d3grfa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3grfa1