Lineage for d3grcd_ (3grc D:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2438294Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2438295Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 2438674Family c.23.1.0: automated matches [191324] (1 protein)
    not a true family
  6. 2438675Protein automated matches [190131] (73 species)
    not a true protein
  7. 2438895Species Polaromonas sp. [TaxId:296591] [225647] (1 PDB entry)
  8. 2438899Domain d3grcd_: 3grc D: [210643]
    automated match to d1chna_

Details for d3grcd_

PDB Entry: 3grc (more details), 2.21 Å

PDB Description: Crystal structure of a sensor protein from Polaromonas sp. JS666
PDB Compounds: (D:) Sensor protein, Kinase

SCOPe Domain Sequences for d3grcd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3grcd_ c.23.1.0 (D:) automated matches {Polaromonas sp. [TaxId: 296591]}
prpriliceddpdiarllnlmlekggfdsdmvhsaaqaleqvarrpyaamtvdlnlpdqd
gvsliralrrdsrtrdlaivvvsanaregelefnsqplavstwlekpidenllilslhra
idnma

SCOPe Domain Coordinates for d3grcd_:

Click to download the PDB-style file with coordinates for d3grcd_.
(The format of our PDB-style files is described here.)

Timeline for d3grcd_: