Lineage for d3grcb_ (3grc B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2855424Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 2855811Family c.23.1.0: automated matches [191324] (1 protein)
    not a true family
  6. 2855812Protein automated matches [190131] (86 species)
    not a true protein
  7. 2856063Species Polaromonas sp. [TaxId:296591] [225647] (1 PDB entry)
  8. 2856065Domain d3grcb_: 3grc B: [210641]
    automated match to d1chna_

Details for d3grcb_

PDB Entry: 3grc (more details), 2.21 Å

PDB Description: crystal structure of a sensor protein from polaromonas sp. js666
PDB Compounds: (B:) Sensor protein, Kinase

SCOPe Domain Sequences for d3grcb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3grcb_ c.23.1.0 (B:) automated matches {Polaromonas sp. [TaxId: 296591]}
prpriliceddpdiarllnlmlekggfdsdmvhsaaqaleqvarrpyaamtvdlnlpdqd
gvsliralrrdsrtrdlaivvvsanaregelefnsqplavstwlekpidenllilslhra
idn

SCOPe Domain Coordinates for d3grcb_:

Click to download the PDB-style file with coordinates for d3grcb_.
(The format of our PDB-style files is described here.)

Timeline for d3grcb_: