| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.1: CheY-like [52172] (8 families) ![]() |
| Family c.23.1.0: automated matches [191324] (1 protein) not a true family |
| Protein automated matches [190131] (86 species) not a true protein |
| Species Polaromonas sp. [TaxId:296591] [225647] (1 PDB entry) |
| Domain d3grca_: 3grc A: [210640] automated match to d1chna_ |
PDB Entry: 3grc (more details), 2.21 Å
SCOPe Domain Sequences for d3grca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3grca_ c.23.1.0 (A:) automated matches {Polaromonas sp. [TaxId: 296591]}
prpriliceddpdiarllnlmlekggfdsdmvhsaaqaleqvarrpyaamtvdlnlpdqd
gvsliralrrdsrtrdlaivvvsanaregelefnsqplavstwlekpidenllilslhra
idnma
Timeline for d3grca_: