Lineage for d1knoc2 (1kno C:109-214)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 287096Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 288543Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
  6. 289615Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)
  7. 289708Species Mouse (Mus musculus) [TaxId:10090] [88567] (225 PDB entries)
  8. 289957Domain d1knoc2: 1kno C:109-214 [21064]
    Other proteins in same PDB: d1knoa1, d1knob1, d1knob2, d1knoc1, d1knod1, d1knod2, d1knoe1, d1knof1, d1knof2

Details for d1knoc2

PDB Entry: 1kno (more details), 3.2 Å

PDB Description: crystal structure of the complex of a catalytic antibody fab with a transition state analog: structural similarities in esterase-like abzymes

SCOP Domain Sequences for d1knoc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1knoc2 b.1.1.2 (C:109-214) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus)}
adaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqds
kdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

SCOP Domain Coordinates for d1knoc2:

Click to download the PDB-style file with coordinates for d1knoc2.
(The format of our PDB-style files is described here.)

Timeline for d1knoc2: