| Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds) |
| Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily) 2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology |
Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (3 families) ![]() flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles) |
| Family e.6.1.0: automated matches [227203] (1 protein) not a true family |
| Protein automated matches [226934] (29 species) not a true protein |
| Species Burkholderia pseudomallei [TaxId:320372] [225462] (6 PDB entries) |
| Domain d3gqtc1: 3gqt C:4-242 [210636] Other proteins in same PDB: d3gqta2, d3gqtb2, d3gqtc2, d3gqtd2 automated match to d1siqa2 complexed with ufo |
PDB Entry: 3gqt (more details), 1.99 Å
SCOPe Domain Sequences for d3gqtc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3gqtc1 e.6.1.0 (C:4-242) automated matches {Burkholderia pseudomallei [TaxId: 320372]}
atfhwddpllldqqladdermvrdaahayaqgklaprvteafrhettdaaifremgeigl
lgptipeqyggpgldyvsygliarevervdsgyrsmmsvqsslvmvpifefgsdaqkeky
lpklatgewigcfgltepnhgsdpgsmvtrarkvpggyslsgskmwitnspiadvfvvwa
kldedgrdeirgfilekgckglsapaihgkvglrasitgeivldeafvpeenilphvkg
Timeline for d3gqtc1: