Lineage for d3gp7b2 (3gp7 B:122-237)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2177211Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2179689Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families) (S)
  5. 2179690Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (16 proteins)
  6. 2179712Protein Staphylococcal enterotoxin B, SEB [54342] (1 species)
  7. 2179713Species Staphylococcus aureus [TaxId:1280] [54343] (18 PDB entries)
  8. 2179716Domain d3gp7b2: 3gp7 B:122-237 [210631]
    Other proteins in same PDB: d3gp7a1, d3gp7b1
    automated match to d1d5zc2
    mutant

Details for d3gp7b2

PDB Entry: 3gp7 (more details), 1.9 Å

PDB Description: staphylococcal enterotoxin b mutant n23yk97sk98s
PDB Compounds: (B:) enterotoxin type b

SCOPe Domain Sequences for d3gp7b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gp7b2 d.15.6.1 (B:122-237) Staphylococcal enterotoxin B, SEB {Staphylococcus aureus [TaxId: 1280]}
ngnqldkyrsitvrvfedgknllsfdvqtnkkkvtaqeldyltrhylvknkklyefnnsp
yetgyikfienensfwydmmpapgdkfdqskylmmyndnkmvdskdvkievylttk

SCOPe Domain Coordinates for d3gp7b2:

Click to download the PDB-style file with coordinates for d3gp7b2.
(The format of our PDB-style files is described here.)

Timeline for d3gp7b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3gp7b1