SCOPe 2.03: Domain d3gp7b1: 3gp7 B:2-121

Lineage for d3gp7b1 (3gp7 B:2-121)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families)

5. Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (16 proteins)

6. Protein Staphylococcal enterotoxin B, SEB [50226] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [50227] (14 PDB entries)

8. Domain d3gp7b1: 3gp7 B:2-121 [210630]
   Other proteins in same PDB: d3gp7a2, d3gp7b2
   automated match to d1d5zc1
   mutant

Details for d3gp7b1

PDB Entry: 3gp7, 1.9 Å

PDB Description: staphylococcal enterotoxin b mutant n23yk97sk98s

PDB Compounds: (B:) enterotoxin type b

SCOPe Domain Sequences for d3gp7b1:

Sequence, based on SEQRES records:

>d3gp7b1 b.40.2.2 (B:2-121) Staphylococcal enterotoxin B, SEB {Staphylococcus aureus [TaxId: 1280]}
sqpdpkpdelhksskftglmeymkvlyddnhvsainvksidqflyfdliysikdtklgny
dnvrvefknkdladkykdkyvdvfganyyyqcyfssstndinshqtdkrktcmyggvteh

Sequence, based on observed residues (ATOM records):

>d3gp7b1 b.40.2.2 (B:2-121) Staphylococcal enterotoxin B, SEB {Staphylococcus aureus [TaxId: 1280]}
sqpdpkpdelhksskftglmeymkvlyddnhvsainvksidqflyfdliysikdtklgny
dnvrvefknkdladkykdkyvdvfganyyyqcyfsrktcmyggvteh

Timeline for d3gp7b1:

• d3gp7b1 is new in SCOPe 2.03-stable
  
• d3gp7b1 appears in SCOPe 2.04
  
• d3gp7b1 appears in the current release, SCOPe 2.08