Lineage for d1knob2 (1kno B:120-235)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 52912Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 53260Protein Immunoglobulin (constant domains of L and H chains) [48972] (161 species)
  7. 53685Species Fab CNJ206 (mouse), kappa L chain [49012] (2 PDB entries)
  8. 53687Domain d1knob2: 1kno B:120-235 [21063]
    Other proteins in same PDB: d1knoa1, d1knob1, d1knoc1, d1knod1, d1knoe1, d1knof1

Details for d1knob2

PDB Entry: 1kno (more details), 3.2 Å

PDB Description: crystal structure of the complex of a catalytic antibody fab with a transition state analog: structural similarities in esterase-like abzymes

SCOP Domain Sequences for d1knob2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1knob2 b.1.1.2 (B:120-235) Immunoglobulin (constant domains of L and H chains) {Fab CNJ206 (mouse), kappa L chain}
akttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsd
lytlsssvtvtsstwpsqsitcnvahpasstkvdkkieprg

SCOP Domain Coordinates for d1knob2:

Click to download the PDB-style file with coordinates for d1knob2.
(The format of our PDB-style files is described here.)

Timeline for d1knob2: