![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families) ![]() |
![]() | Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (16 proteins) |
![]() | Protein Staphylococcal enterotoxin B, SEB [54342] (1 species) |
![]() | Species Staphylococcus aureus [TaxId:1280] [54343] (18 PDB entries) |
![]() | Domain d3gp7a2: 3gp7 A:122-238 [210629] Other proteins in same PDB: d3gp7a1, d3gp7b1 automated match to d1d5zc2 mutant |
PDB Entry: 3gp7 (more details), 1.9 Å
SCOPe Domain Sequences for d3gp7a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3gp7a2 d.15.6.1 (A:122-238) Staphylococcal enterotoxin B, SEB {Staphylococcus aureus [TaxId: 1280]} ngnqldkyrsitvrvfedgknllsfdvqtnkkkvtaqeldyltrhylvknkklyefnnsp yetgyikfienensfwydmmpapgdkfdqskylmmyndnkmvdskdvkievylttkk
Timeline for d3gp7a2: