Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
Superfamily c.95.1: Thiolase-like [53901] (3 families) |
Family c.95.1.0: automated matches [196908] (1 protein) not a true family |
Protein automated matches [196909] (52 species) not a true protein |
Species Salmonella typhimurium [TaxId:602] [225638] (1 PDB entry) |
Domain d3goab2: 3goa B:260-387 [210625] automated match to d1wdkc2 complexed with ca, cl, na |
PDB Entry: 3goa (more details), 1.7 Å
SCOPe Domain Sequences for d3goab2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3goab2 c.95.1.0 (B:260-387) automated matches {Salmonella typhimurium [TaxId: 602]} glkprarirsmavvgcdpsimgygpvpasklalkkaglsasdidvfemneafaaqilpci kdlglmeqidekinlnggaialghplgcsgaristtlinlmerkdaqfglatmciglgqg iatvferv
Timeline for d3goab2: