Lineage for d3goab2 (3goa B:260-387)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1392123Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 1392124Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 1392829Family c.95.1.0: automated matches [196908] (1 protein)
    not a true family
  6. 1392830Protein automated matches [196909] (40 species)
    not a true protein
  7. 1393115Species Salmonella typhimurium [TaxId:602] [225638] (1 PDB entry)
  8. 1393119Domain d3goab2: 3goa B:260-387 [210625]
    automated match to d1wdkc2
    complexed with ca, cl, na

Details for d3goab2

PDB Entry: 3goa (more details), 1.7 Å

PDB Description: crystal structure of the salmonella typhimurium fada 3-ketoacyl-coa thiolase
PDB Compounds: (B:) 3-ketoacyl-CoA thiolase

SCOPe Domain Sequences for d3goab2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3goab2 c.95.1.0 (B:260-387) automated matches {Salmonella typhimurium [TaxId: 602]}
glkprarirsmavvgcdpsimgygpvpasklalkkaglsasdidvfemneafaaqilpci
kdlglmeqidekinlnggaialghplgcsgaristtlinlmerkdaqfglatmciglgqg
iatvferv

SCOPe Domain Coordinates for d3goab2:

Click to download the PDB-style file with coordinates for d3goab2.
(The format of our PDB-style files is described here.)

Timeline for d3goab2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3goab1