SCOPe 2.04: Domain d3goaa2: 3goa A:260-387

Lineage for d3goaa2 (3goa A:260-387)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.0: automated matches [196908] (1 protein)
   not a true family

6. Protein automated matches [196909] (45 species)
   not a true protein

7. Species Salmonella typhimurium [TaxId:602] [225638] (1 PDB entry)

8. Domain d3goaa2: 3goa A:260-387 [210623]
   automated match to d1wdkc2
   complexed with ca, cl, na

Details for d3goaa2

PDB Entry: 3goa, 1.7 Å

PDB Description: crystal structure of the salmonella typhimurium fada 3-ketoacyl-coa thiolase

PDB Compounds: (A:) 3-ketoacyl-CoA thiolase

SCOPe Domain Sequences for d3goaa2:

Sequence; same for both SEQRES and ATOM records:

>d3goaa2 c.95.1.0 (A:260-387) automated matches {Salmonella typhimurium [TaxId: 602]}
glkprarirsmavvgcdpsimgygpvpasklalkkaglsasdidvfemneafaaqilpci
kdlglmeqidekinlnggaialghplgcsgaristtlinlmerkdaqfglatmciglgqg
iatvferv

Timeline for d3goaa2:

• d3goaa2 first appeared in SCOPe 2.03
  
• d3goaa2 appears in SCOPe 2.05
  
• d3goaa2 appears in the current release, SCOPe 2.08