![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
![]() | Superfamily c.95.1: Thiolase-like [53901] (3 families) ![]() |
![]() | Family c.95.1.0: automated matches [196908] (1 protein) not a true family |
![]() | Protein automated matches [196909] (83 species) not a true protein |
![]() | Species Salmonella typhimurium [TaxId:602] [225638] (1 PDB entry) |
![]() | Domain d3goaa1: 3goa A:1-259 [210622] automated match to d1wdkc1 complexed with ca, cl, na |
PDB Entry: 3goa (more details), 1.7 Å
SCOPe Domain Sequences for d3goaa1:
Sequence, based on SEQRES records: (download)
>d3goaa1 c.95.1.0 (A:1-259) automated matches {Salmonella typhimurium [TaxId: 602]} meqvvivdairtpmgrskggafrnvraedlsahlmrsllarnpsltaatlddiywgcvqq tleqgfniarnaallaeiphsvpavtvnrlcgssmqalhdaarmimtgdaqvclvggveh mghvpmshgvdfhpglsrnvakaagmmgltaemlsrlhgisremqdqfaarsharawaat qsgafkteiiptgghdadgvlkqfnydevirpettvealstlrpafdpvsgtvtagtssa lsdgaaamlvmsesrarel
>d3goaa1 c.95.1.0 (A:1-259) automated matches {Salmonella typhimurium [TaxId: 602]} meqvvivdairtpmgrskggafrnvraedlsahlmrsllarnpsltaatlddiywgcvqq tleqgfniarnaallaeiphsvpavtvnrlcgssmqalhdaarmimtgdaqvclvggveh mghvpmshgvdfhpglsgmmgltaemlsrlhgisremqdqfaarsharawaatqsgafkt eiiptgghdadgvlkqfnydevirpettvealstlrpafdpvsgtvtagtssalsdgaaa mlvmsesrarel
Timeline for d3goaa1: