Lineage for d1knoa2 (1kno A:109-214)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 362615Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 362616Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 364354Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
  6. 365639Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)
  7. 365760Species Mouse (Mus musculus) [TaxId:10090] [88567] (270 PDB entries)
  8. 366059Domain d1knoa2: 1kno A:109-214 [21062]
    Other proteins in same PDB: d1knoa1, d1knob1, d1knob2, d1knoc1, d1knod1, d1knod2, d1knoe1, d1knof1, d1knof2

Details for d1knoa2

PDB Entry: 1kno (more details), 3.2 Å

PDB Description: crystal structure of the complex of a catalytic antibody fab with a transition state analog: structural similarities in esterase-like abzymes
PDB Compounds: (A:)

SCOP Domain Sequences for d1knoa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1knoa2 b.1.1.2 (A:109-214) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus)}
adaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqds
kdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

SCOP Domain Coordinates for d1knoa2:

Click to download the PDB-style file with coordinates for d1knoa2.
(The format of our PDB-style files is described here.)

Timeline for d1knoa2: