Lineage for d3gncd2 (3gnc D:243-393)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2706693Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2708344Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families) (S)
    multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel
  5. 2708478Family a.29.3.0: automated matches [227204] (1 protein)
    not a true family
  6. 2708479Protein automated matches [226935] (30 species)
    not a true protein
  7. 2708527Species Burkholderia pseudomallei [TaxId:320372] [225463] (6 PDB entries)
  8. 2708539Domain d3gncd2: 3gnc D:243-393 [210616]
    Other proteins in same PDB: d3gnca1, d3gncb1, d3gncc1, d3gncd1
    automated match to d1siqa1
    complexed with epe, qqq, so4

Details for d3gncd2

PDB Entry: 3gnc (more details), 2.15 Å

PDB Description: Crystal structure of Glutaryl-COA dehydrogenase from Burkholderia Pseudomallei with fragment 6421
PDB Compounds: (D:) Glutaryl-CoA dehydrogenase

SCOPe Domain Sequences for d3gncd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gncd2 a.29.3.0 (D:243-393) automated matches {Burkholderia pseudomallei [TaxId: 320372]}
lrgpftclnsarygiawgalgaaescwhiarqyvldrkqfgrplaanqliqkkladmqte
itlglqgvlrlgrmkdegtaaveitsimkrnscgkaldiarlardmlggngisdefgvar
hlvnlevvntyegthdihalilgraqtgiqa

SCOPe Domain Coordinates for d3gncd2:

Click to download the PDB-style file with coordinates for d3gncd2.
(The format of our PDB-style files is described here.)

Timeline for d3gncd2: