SCOPe 2.03: Domain d3gncb2: 3gnc B:243-393

Lineage for d3gncb2 (3gnc B:243-393)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families)
   multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel

5. Family a.29.3.0: automated matches [227204] (1 protein)
   not a true family

6. Protein automated matches [226935] (15 species)
   not a true protein

7. Species Burkholderia pseudomallei [TaxId:320372] [225463] (6 PDB entries)

8. Domain d3gncb2: 3gnc B:243-393 [210612]
   Other proteins in same PDB: d3gnca1, d3gncb1, d3gncc1, d3gncd1
   automated match to d1siqa1
   complexed with epe, qqq, so4

Details for d3gncb2

PDB Entry: 3gnc, 2.15 Å

PDB Description: Crystal structure of Glutaryl-COA dehydrogenase from Burkholderia Pseudomallei with fragment 6421

PDB Compounds: (B:) Glutaryl-CoA dehydrogenase

SCOPe Domain Sequences for d3gncb2:

Sequence, based on SEQRES records:

>d3gncb2 a.29.3.0 (B:243-393) automated matches {Burkholderia pseudomallei [TaxId: 320372]}
lrgpftclnsarygiawgalgaaescwhiarqyvldrkqfgrplaanqliqkkladmqte
itlglqgvlrlgrmkdegtaaveitsimkrnscgkaldiarlardmlggngisdefgvar
hlvnlevvntyegthdihalilgraqtgiqa

Sequence, based on observed residues (ATOM records):

>d3gncb2 a.29.3.0 (B:243-393) automated matches {Burkholderia pseudomallei [TaxId: 320372]}
lrgpftclnsarygiawgalgaaescwhiarqyvldrkqfgrplaanqliqkkladmqte
itlglqgvlrlgrmkdegtaaveitsimkrnscgkaldiarlardmlgfgvarhlvnlev
vntyegthdihalilgraqtgiqa

Timeline for d3gncb2:

• d3gncb2 is new in SCOPe 2.03-stable
  
• d3gncb2 appears in SCOPe 2.04
  
• d3gncb2 appears in the current release, SCOPe 2.08