Lineage for d3gn2c_ (3gn2 C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2841375Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7

    has additional subdomain(s) that are not in the common domain
  6. 2841754Protein Dihydropteridin reductase (pteridine reductase) [51769] (7 species)
  7. 2841837Species Trypanosoma brucei [TaxId:5702] [226783] (32 PDB entries)
  8. 2841852Domain d3gn2c_: 3gn2 C: [210605]
    automated match to d1p33a_
    complexed with act, ax8, nap

Details for d3gn2c_

PDB Entry: 3gn2 (more details), 1.6 Å

PDB Description: structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor (nadp+) and inhibitor (ddd00066730)
PDB Compounds: (C:) pteridine reductase

SCOPe Domain Sequences for d3gn2c_:

Sequence, based on SEQRES records: (download)

>d3gn2c_ c.2.1.2 (C:) Dihydropteridin reductase (pteridine reductase) {Trypanosoma brucei [TaxId: 5702]}
apaavvtgaakrigraiavklhqtgyrvvihyhnsaeaavsladelnkersntavvcqad
ltnsnvlpasceeiinscfrafgrcdvlvnnasafyptplvqgdhednsngktvetqvae
ligtnaiapflltmsfaqrqkgtnpnctssnlsivnlcdamvdqpcmafslynmgkhalv
gltqsaalelapygirvngvapgvsllpvamgeeekdkwrrkvplgrreasaeqiadavi
flvsgsaqyitgsiikvdgglslvha

Sequence, based on observed residues (ATOM records): (download)

>d3gn2c_ c.2.1.2 (C:) Dihydropteridin reductase (pteridine reductase) {Trypanosoma brucei [TaxId: 5702]}
apaavvtgaakrigraiavklhqtgyrvvihyhnsaeaavsladelnkersntavvcqad
ltnsnvlpasceeiinscfrafgrcdvlvnnasafyptplvgktvetqvaeligtnaiap
flltmsfaqrqsnlsivnlcdamvdqpcmafslynmgkhalvgltqsaalelapygirvn
gvapgvsllpvamgeeekdkwrrkvplgrreasaeqiadaviflvsgsaqyitgsiikvd
gglslvha

SCOPe Domain Coordinates for d3gn2c_:

Click to download the PDB-style file with coordinates for d3gn2c_.
(The format of our PDB-style files is described here.)

Timeline for d3gn2c_: