Class b: All beta proteins [48724] (144 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species) |
Species Mouse (Mus musculus) [TaxId:10090] [88567] (277 PDB entries) |
Domain d2gfbo2: 2gfb O:109-214 [21060] Other proteins in same PDB: d2gfba1, d2gfbb1, d2gfbb2, d2gfbc1, d2gfbd1, d2gfbd2, d2gfbe1, d2gfbf1, d2gfbf2, d2gfbg1, d2gfbh1, d2gfbh2, d2gfbi1, d2gfbj1, d2gfbj2, d2gfbk1, d2gfbl1, d2gfbl2, d2gfbm1, d2gfbn1, d2gfbn2, d2gfbo1, d2gfbp1, d2gfbp2 part of Fab CNJ206; H-chains in this entry seem to be mistraced in VH region |
PDB Entry: 2gfb (more details), 3 Å
SCOP Domain Sequences for d2gfbo2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gfbo2 b.1.1.2 (O:109-214) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus)} ggaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqds kdstysmsstltltkdeyerhnsytceathktstspivksfnrnec
Timeline for d2gfbo2:
View in 3D Domains from other chains: (mouse over for more information) d2gfba1, d2gfba2, d2gfbb1, d2gfbb2, d2gfbc1, d2gfbc2, d2gfbd1, d2gfbd2, d2gfbe1, d2gfbe2, d2gfbf1, d2gfbf2, d2gfbg1, d2gfbg2, d2gfbh1, d2gfbh2, d2gfbi1, d2gfbi2, d2gfbj1, d2gfbj2, d2gfbk1, d2gfbk2, d2gfbl1, d2gfbl2, d2gfbm1, d2gfbm2, d2gfbn1, d2gfbn2, d2gfbp1, d2gfbp2 |