SCOP 1.57: Domain d2gfbo2: 2gfb O:109-214

Lineage for d2gfbo2 (2gfb O:109-214)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (161 species)

7. Species Fab CNJ206 (mouse), kappa L chain [49012] (2 PDB entries)

8. Domain d2gfbo2: 2gfb O:109-214 [21060]
   Other proteins in same PDB: d2gfba1, d2gfbb1, d2gfbc1, d2gfbd1, d2gfbe1, d2gfbf1, d2gfbg1, d2gfbh1, d2gfbi1, d2gfbj1, d2gfbk1, d2gfbl1, d2gfbm1, d2gfbn1, d2gfbo1, d2gfbp1

Details for d2gfbo2

PDB Entry: 2gfb, 3 Å

PDB Description: crystal structure of a catalytic fab having esterase-like activity

SCOP Domain Sequences for d2gfbo2:

Sequence; same for both SEQRES and ATOM records:

>d2gfbo2 b.1.1.2 (O:109-214) Immunoglobulin (constant domains of L and H chains) {Fab CNJ206 (mouse), kappa L chain}
ggaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqds
kdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

Timeline for d2gfbo2:

• d2gfbo2 first appeared (with stable ids) in SCOP 1.55
  
• d2gfbo2 appears in SCOP 1.59
  
• d2gfbo2 appears in the current release, SCOPe 2.08