Class b: All beta proteins [48724] (104 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
Protein Immunoglobulin (constant domains of L and H chains) [48972] (161 species) |
Species Fab CNJ206 (mouse), kappa L chain [49012] (2 PDB entries) |
Domain d2gfbo2: 2gfb O:109-214 [21060] Other proteins in same PDB: d2gfba1, d2gfbb1, d2gfbc1, d2gfbd1, d2gfbe1, d2gfbf1, d2gfbg1, d2gfbh1, d2gfbi1, d2gfbj1, d2gfbk1, d2gfbl1, d2gfbm1, d2gfbn1, d2gfbo1, d2gfbp1 |
PDB Entry: 2gfb (more details), 3 Å
SCOP Domain Sequences for d2gfbo2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gfbo2 b.1.1.2 (O:109-214) Immunoglobulin (constant domains of L and H chains) {Fab CNJ206 (mouse), kappa L chain} ggaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqds kdstysmsstltltkdeyerhnsytceathktstspivksfnrnec
Timeline for d2gfbo2:
View in 3D Domains from other chains: (mouse over for more information) d2gfba1, d2gfba2, d2gfbb1, d2gfbb2, d2gfbc1, d2gfbc2, d2gfbd1, d2gfbd2, d2gfbe1, d2gfbe2, d2gfbf1, d2gfbf2, d2gfbg1, d2gfbg2, d2gfbh1, d2gfbh2, d2gfbi1, d2gfbi2, d2gfbj1, d2gfbj2, d2gfbk1, d2gfbk2, d2gfbl1, d2gfbl2, d2gfbm1, d2gfbm2, d2gfbn1, d2gfbn2, d2gfbp1, d2gfbp2 |