| Class b: All beta proteins [48724] (180 folds) |
| Fold b.26: SMAD/FHA domain [49878] (1 superfamily) sandwich; 11 strands in 2 sheets; greek-key |
Superfamily b.26.1: SMAD/FHA domain [49879] (5 families) ![]() has a few short helices inserted in loops |
| Family b.26.1.0: automated matches [191616] (1 protein) not a true family |
| Protein automated matches [191125] (8 species) not a true protein |
| Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [225792] (1 PDB entry) |
| Domain d3gmja_: 3gmj A: [210596] automated match to d1mr1b_ |
PDB Entry: 3gmj (more details), 2.8 Å
SCOPe Domain Sequences for d3gmja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3gmja_ b.26.1.0 (A:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
epafwasiayyelncrvgevfhcnnnsvivdgftnpsnnsdrcclgqlsnvnrnstient
rrhigkgvhlyyvtgevyaeclsdsaifvqsrncnyqhgfhpstvckippgcslkifnnq
efaqllsqsvnngfeavyeltkmctirmsfvkgwgaeyhrqdvtstpcwieihlhgplqw
ldkvltqmgsphnaissvs
Timeline for d3gmja_: