Lineage for d3gmaa2 (3gma A:292-586)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2099098Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2099099Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2099797Family c.14.1.4: Biotin dependent carboxylase carboxyltransferase domain [89572] (7 protein domains)
    Pfam PF01039
    the active site is formed by two different homologous subunits or domains of this fold
  6. 2099850Protein Glutaconyl-CoA decarboxylase A subunit [102210] (2 species)
  7. 2099856Species Clostridium symbiosum [TaxId:1512] [225715] (4 PDB entries)
  8. 2099870Domain d3gmaa2: 3gma A:292-586 [210593]
    automated match to d1pixa3
    complexed with gra

Details for d3gmaa2

PDB Entry: 3gma (more details), 2.6 Å

PDB Description: Glutaconyl-coA decarboxylase A subunit from Clostridium symbiosum co-crystallized with glutaryl-CoA
PDB Compounds: (A:) Glutaconyl-CoA decarboxylase subunit A

SCOPe Domain Sequences for d3gmaa2:

Sequence, based on SEQRES records: (download)

>d3gmaa2 c.14.1.4 (A:292-586) Glutaconyl-CoA decarboxylase A subunit {Clostridium symbiosum [TaxId: 1512]}
ynleffrvdtpkapqlpaedlysiipmnqkrpydiyeviarlfdnsefseykkgygpemv
tglakvngllvgvianvqgllmnypeykqnsvgiggklyrqglikmnefvtlcardripl
iwlqdttgidvgdeaekaellglgqsliysiensklpsleitirkasaaahyvlggpqgn
ntnvfsigtgaceyyvmpgetaanamysrklvkakkagedlqpiigkmndmiqmytdksr
pkyctekgmvdeivdmtevrpyiqafteaayqnpqsicpmhqmltprstrefetf

Sequence, based on observed residues (ATOM records): (download)

>d3gmaa2 c.14.1.4 (A:292-586) Glutaconyl-CoA decarboxylase A subunit {Clostridium symbiosum [TaxId: 1512]}
ynleffrvdtpkapqlpaedlysiipmnqkrpydiyeviarlfdnsefseykkgygpemv
tglakvngllvgvianvqgllmnypeykqnsvgiggklyrqglikmnefvtlcardripl
iwlqdttgidvgdeaekaellglgqsliysiensklpsleitirkasaaahyvlggpqgn
ntnvfsigtgaceyyvmpgetaanamysrkqpiigkmndmiqmytdksrpkyctekgmvd
eivdmtevrpyiqafteaayqnpqsicpmhqmltprstrefetf

SCOPe Domain Coordinates for d3gmaa2:

Click to download the PDB-style file with coordinates for d3gmaa2.
(The format of our PDB-style files is described here.)

Timeline for d3gmaa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3gmaa1