SCOPe 2.03: Domain d3glsb_: 3gls B:

Lineage for d3glsb_ (3gls B:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like

4. Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families)
   binds cofactor molecules in the opposite direction than classical Rossmann fold

5. Family c.31.1.0: automated matches [191352] (1 protein)
   not a true family

6. Protein automated matches [190312] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [224883] (9 PDB entries)

8. Domain d3glsb_: 3gls B: [210587]
   automated match to d1j8fc_
   complexed with pge, so4, zn

Details for d3glsb_

PDB Entry: 3gls, 2.7 Å

PDB Description: Crystal Structure of Human SIRT3

PDB Compounds: (B:) NAD-dependent deacetylase sirtuin-3, mitochondrial

SCOPe Domain Sequences for d3glsb_:

Sequence; same for both SEQRES and ATOM records:

>d3glsb_ c.31.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lslqdvaeliraracqrvvvmvgagistpsgipdfrspgsglysnlqqydlpypeaifel
pfffhnpkpfftlakelypgnykpnvthyflrllhdkglllrlytqnidglervsgipas
klveahgtfasatctvcqrpfpgediradvmadrvprcpvctgvvkpdivffgeplpqrf
llhvvdfpmadlllilgtslevepfaslteavrssvprllinrdlvgplawhprsrdvaq
lgdvvhgveslvellgwteemrdlvqretgkl

Timeline for d3glsb_:

• d3glsb_ is new in SCOPe 2.03-stable
  
• d3glsb_ appears in SCOPe 2.04
  
• d3glsb_ appears in the current release, SCOPe 2.08