Lineage for d3glsa_ (3gls A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2862578Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like
  4. 2862579Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families) (S)
    binds cofactor molecules in the opposite direction than classical Rossmann fold
  5. 2863020Family c.31.1.0: automated matches [191352] (1 protein)
    not a true family
  6. 2863021Protein automated matches [190312] (14 species)
    not a true protein
  7. 2863043Species Human (Homo sapiens) [TaxId:9606] [224883] (17 PDB entries)
  8. 2863062Domain d3glsa_: 3gls A: [210586]
    automated match to d1j8fc_
    complexed with pge, so4, zn

Details for d3glsa_

PDB Entry: 3gls (more details), 2.7 Å

PDB Description: Crystal Structure of Human SIRT3
PDB Compounds: (A:) NAD-dependent deacetylase sirtuin-3, mitochondrial

SCOPe Domain Sequences for d3glsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3glsa_ c.31.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
klslqdvaeliraracqrvvvmvgagistpsgipdfrspgsglysnlqqydlpypeaife
lpfffhnpkpfftlakelypgnykpnvthyflrllhdkglllrlytqnidglervsgipa
sklveahgtfasatctvcqrpfpgediradvmadrvprcpvctgvvkpdivffgeplpqr
fllhvvdfpmadlllilgtslevepfaslteavrssvprllinrdlvgplawhprsrdva
qlgdvvhgveslvellgwteemrdlvqretgkl

SCOPe Domain Coordinates for d3glsa_:

Click to download the PDB-style file with coordinates for d3glsa_.
(The format of our PDB-style files is described here.)

Timeline for d3glsa_: