Lineage for d3glmd1 (3glm D:3-291)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2852293Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2852294Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2853345Family c.14.1.4: Biotin dependent carboxylase carboxyltransferase domain [89572] (9 proteins)
    Pfam PF01039
    the active site is formed by two different homologous subunits or domains of this fold
  6. 2853413Protein Glutaconyl-CoA decarboxylase A subunit, N-terminal domain [418958] (2 species)
  7. 2853417Species Clostridium symbiosum [TaxId:1512] [419420] (4 PDB entries)
  8. 2853423Domain d3glmd1: 3glm D:3-291 [210584]
    Other proteins in same PDB: d3glma2, d3glmb2, d3glmc2, d3glmd2
    automated match to d1pixa2
    complexed with cl, coo

    has additional insertions and/or extensions that are not grouped together

Details for d3glmd1

PDB Entry: 3glm (more details), 2.5 Å

PDB Description: Glutaconyl-coA decarboxylase A subunit from Clostridium symbiosum co-crystallized with crotonyl-coA
PDB Compounds: (D:) Glutaconyl-CoA decarboxylase subunit A

SCOPe Domain Sequences for d3glmd1:

Sequence, based on SEQRES records: (download)

>d3glmd1 c.14.1.4 (D:3-291) Glutaconyl-CoA decarboxylase A subunit, N-terminal domain {Clostridium symbiosum [TaxId: 1512]}
mysmpgyfqnmptigkelvnpnpeneqeikavesdihesikkaldagitseeklnergql
samqrinalidpgtwcplnslfnpennkfgttnivnglgrvdgkwvyivasdnkkmagaw
vpgqaenlircsdaakmmhlpliyllncsgvefpnqdkvypnrrgggtpffrnselnqlg
ipvivgiygtnpagggyhsisptiliahqdanmavggagilsgmnpkgyiddeaaeqiia
aqiensklkvpapgsvpihydetgffrevyqndlgvidgikkyisylpa

Sequence, based on observed residues (ATOM records): (download)

>d3glmd1 c.14.1.4 (D:3-291) Glutaconyl-CoA decarboxylase A subunit, N-terminal domain {Clostridium symbiosum [TaxId: 1512]}
mysmpgyfqnmptigkelvnpnpeneqeikavesdihesikkaldagitseeklnergql
samqrinalidpgtwcplnslfnpennkfgttnivnglgrvdgkwvyivasdnkkmagaw
vpgqaenlircsdaakmmhlpliyllncsgvefpnqdkvypnrrgggtpffrnselnqlg
ipvivgiygtnpagggyhsisptiliahqdanmavggagaeqiiaaqiensklkvpapgs
vpihydetgffrevyqndlgvidgikkyisylpa

SCOPe Domain Coordinates for d3glmd1:

Click to download the PDB-style file with coordinates for d3glmd1.
(The format of our PDB-style files is described here.)

Timeline for d3glmd1: