![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.14: ClpP/crotonase [52095] (1 superfamily) core: 4 turns of (beta-beta-alpha)n superhelix |
![]() | Superfamily c.14.1: ClpP/crotonase [52096] (5 families) ![]() |
![]() | Family c.14.1.4: Biotin dependent carboxylase carboxyltransferase domain [89572] (7 proteins) Pfam PF01039 the active site is formed by two different homologous subunits or domains of this fold |
![]() | Protein Glutaconyl-CoA decarboxylase A subunit [102210] (2 species) |
![]() | Species Clostridium symbiosum [TaxId:1512] [225715] (4 PDB entries) |
![]() | Domain d3glmb1: 3glm B:3-291 [210580] automated match to d1pixa2 complexed with cl, coo |
PDB Entry: 3glm (more details), 2.5 Å
SCOPe Domain Sequences for d3glmb1:
Sequence, based on SEQRES records: (download)
>d3glmb1 c.14.1.4 (B:3-291) Glutaconyl-CoA decarboxylase A subunit {Clostridium symbiosum [TaxId: 1512]} mysmpgyfqnmptigkelvnpnpeneqeikavesdihesikkaldagitseeklnergql samqrinalidpgtwcplnslfnpennkfgttnivnglgrvdgkwvyivasdnkkmagaw vpgqaenlircsdaakmmhlpliyllncsgvefpnqdkvypnrrgggtpffrnselnqlg ipvivgiygtnpagggyhsisptiliahqdanmavggagilsgmnpkgyiddeaaeqiia aqiensklkvpapgsvpihydetgffrevyqndlgvidgikkyisylpa
>d3glmb1 c.14.1.4 (B:3-291) Glutaconyl-CoA decarboxylase A subunit {Clostridium symbiosum [TaxId: 1512]} mysmpgyfqnmptigkelvnpnpeneqeikavesdihesikkaldagitseeklnergql samqrinalidpgtwcplnslfnpennkfgttnivnglgrvdgkwvyivasdnkkmagaw vpgqaenlircsdaakmmhlpliyllncsgvefpnqdkvypnrrgggtpffrnselnqlg ipvivgiygtnpagggyhsisptiliahqdanmavggagaeqiiaaqiensklkvpapgs vpihydetgffrevyqndlgvidgikkyisylpa
Timeline for d3glmb1: