SCOPe 2.03: Domain d3gl1a1: 3gl1 A:2-191

Lineage for d3gl1a1 (3gl1 A:2-191)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (15 families)
   duplication contains two domains of this fold

5. Family c.55.1.0: automated matches [227137] (1 protein)
   not a true family

6. Protein automated matches [226839] (35 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [225411] (5 PDB entries)

8. Domain d3gl1a1: 3gl1 A:2-191 [210572]
   automated match to d2qw9a1
   complexed with cl, gol, mg

Details for d3gl1a1

PDB Entry: 3gl1, 1.92 Å

PDB Description: crystal structure of atpase domain of ssb1 chaperone, a member of the hsp70 family, from saccharomyces cerevisiae

PDB Compounds: (A:) Heat shock protein SSB1

SCOPe Domain Sequences for d3gl1a1:

Sequence; same for both SEQRES and ATOM records:

>d3gl1a1 c.55.1.0 (A:2-191) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
aegvfqgaigidlgttyscvatyessveiianeqgnrvtpsfvaftpeerligdaaknqa
alnprntvfdakrligrrfddesvqkdmktwpfkvidvdgnpvievqyleetktfspqei
samvltkmkeiaeakigkkvekavitvpayfndaqrqatkdagaisglnvlriineptaa
aiayglgagk

Timeline for d3gl1a1:

• d3gl1a1 is new in SCOPe 2.03-stable
  
• d3gl1a1 appears in SCOPe 2.04
  
• d3gl1a1 appears in the current release, SCOPe 2.08