| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) ![]() duplication contains two domains of this fold |
| Family c.55.1.0: automated matches [227137] (1 protein) not a true family |
| Protein automated matches [226839] (64 species) not a true protein |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [225411] (5 PDB entries) |
| Domain d3gl1a1: 3gl1 A:2-191 [210572] automated match to d2qw9a1 complexed with cl, gol, mg |
PDB Entry: 3gl1 (more details), 1.92 Å
SCOPe Domain Sequences for d3gl1a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3gl1a1 c.55.1.0 (A:2-191) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
aegvfqgaigidlgttyscvatyessveiianeqgnrvtpsfvaftpeerligdaaknqa
alnprntvfdakrligrrfddesvqkdmktwpfkvidvdgnpvievqyleetktfspqei
samvltkmkeiaeakigkkvekavitvpayfndaqrqatkdagaisglnvlriineptaa
aiayglgagk
Timeline for d3gl1a1: